(data stored in ACNUC7421 zone)

EMBL: CP000690.PE28

CP000690.PE28        Location/Qualifiers
FT   CDS             33797..34759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3320"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28932"
FT                   /db_xref="GOA:A5FTK0"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK0"
FT                   /protein_id="ABQ28932.1"
FT                   /translation="MSDQAPGLPPPRPIPIRERSSILFLERGQLDVIDGSFVVVDQRGI
FT                   RTVIPVGGITCLMLEPGTRVSHAAVCLAARAGTLLIWVGEAGVRLYAAGQPGGARSDRL
FT                   LYQARLALDDEARLRVVRRMYSIRFQEEPPQRRSVDQLRGIEGVRVRELYKLMAQRHGV
FT                   SWAGRRYDPQNWGGADLVNRCLSAATAALYGISEAAILAAGYAPAIGFLHSGKPQSFVY
FT                   DIADLFKFETVVPEAFKVVAAVQSGRGQIDGMAIGEPVGAVRRRCRDAFRRTNVLARII
FT                   PAIEDVLAAGGLAVPEAPEEAMPVAIPPPEPTGDAGHRG"
     MSDQAPGLPP PRPIPIRERS SILFLERGQL DVIDGSFVVV DQRGIRTVIP VGGITCLMLE        60
     PGTRVSHAAV CLAARAGTLL IWVGEAGVRL YAAGQPGGAR SDRLLYQARL ALDDEARLRV       120
     VRRMYSIRFQ EEPPQRRSVD QLRGIEGVRV RELYKLMAQR HGVSWAGRRY DPQNWGGADL       180
     VNRCLSAATA ALYGISEAAI LAAGYAPAIG FLHSGKPQSF VYDIADLFKF ETVVPEAFKV       240
     VAAVQSGRGQ IDGMAIGEPV GAVRRRCRDA FRRTNVLARI IPAIEDVLAA GGLAVPEAPE       300
     EAMPVAIPPP EPTGDAGHRG                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page