(data stored in ACNUC7421 zone)

EMBL: CP000690.PE29

CP000690.PE29        Location/Qualifiers
FT   CDS             complement(38112..40184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28933"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK1"
FT                   /protein_id="ABQ28933.1"
FT                   /translation="MVKSAVVQIARPAPARRRSGLRLRMLGRTIANEYFYRGGSAARRG
FT                   PTGADVASRRISPDEWHDYTLAISCARRAMSKLKRDAIMASRRHDRPDDDDLVEMIEKR
FT                   RHLRAEVKKRIGAGLVLEPDISCGAFVDGVKLRGFRSSLDPILKLFVSKLCKGRYTRRG
FT                   SRLPSISSSRDKASIFPCPSKALALDDEYVTFNPMMRGVFRVDLDRDFASTEECQEKIR
FT                   ELRLPAPNIITGVSTSGGKLRRPHVYFVVKHSVCFTGNGRNGAKALFKLIGTILTERLA
FT                   PLGADRFATNTLRGKNPLCERLTTAVVYSEPYSLGFDPHGCESLADLLDLGQYRGKFSN
FT                   FGAAEDMLLRDGRRGSNAVFRTVGRLCARLVHEFHPESPRRSARYRANLVGTDHALEDF
FT                   EDAVLRGAQQYFEDCEQLRRQCAKSARYFFTRYDARIASANRRRGAMAAEPEYLAALSK
FT                   REKQQAGGRYAALKCKEATLIRLAVAAEEIGHLAEDIGVSELARASGVSRMTIYRHRHE
FT                   LERGRYLLAEMRENGAAQGDHTIHAGPTSDCNIQCLDKRDTGKSGSLEEMGTPGAEHPE
FT                   GVTQSRRQFIKRRGSRFMGSKSGKVRVHALNPVFILEIPGGSGAKRPRIVRIRDDVDEL
FT                   AYEAAVEPTIRFIDDFGRERMGNEPVIYAHNGAVAWKNPDFADRRNLNSANRRSS"
     MVKSAVVQIA RPAPARRRSG LRLRMLGRTI ANEYFYRGGS AARRGPTGAD VASRRISPDE        60
     WHDYTLAISC ARRAMSKLKR DAIMASRRHD RPDDDDLVEM IEKRRHLRAE VKKRIGAGLV       120
     LEPDISCGAF VDGVKLRGFR SSLDPILKLF VSKLCKGRYT RRGSRLPSIS SSRDKASIFP       180
     CPSKALALDD EYVTFNPMMR GVFRVDLDRD FASTEECQEK IRELRLPAPN IITGVSTSGG       240
     KLRRPHVYFV VKHSVCFTGN GRNGAKALFK LIGTILTERL APLGADRFAT NTLRGKNPLC       300
     ERLTTAVVYS EPYSLGFDPH GCESLADLLD LGQYRGKFSN FGAAEDMLLR DGRRGSNAVF       360
     RTVGRLCARL VHEFHPESPR RSARYRANLV GTDHALEDFE DAVLRGAQQY FEDCEQLRRQ       420
     CAKSARYFFT RYDARIASAN RRRGAMAAEP EYLAALSKRE KQQAGGRYAA LKCKEATLIR       480
     LAVAAEEIGH LAEDIGVSEL ARASGVSRMT IYRHRHELER GRYLLAEMRE NGAAQGDHTI       540
     HAGPTSDCNI QCLDKRDTGK SGSLEEMGTP GAEHPEGVTQ SRRQFIKRRG SRFMGSKSGK       600
     VRVHALNPVF ILEIPGGSGA KRPRIVRIRD DVDELAYEAA VEPTIRFIDD FGRERMGNEP       660
     VIYAHNGAVA WKNPDFADRR NLNSANRRSS                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page