(data stored in ACNUC7421 zone)

EMBL: CP000690.PE30

CP000690.PE30        Location/Qualifiers
FT   CDS             complement(40187..41011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28934"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK2"
FT                   /protein_id="ABQ28934.1"
FT                   /translation="MIDGQEHDVAAEIRIPLIEGAFFAARDRLASELATSGFDPHVAAA
FT                   GANQIGEAILESPTQNEDAAWLIAAMAPAGIARRLAGTDARNTRAALIRDGIAPDIARA
FT                   VVQIAPVSPRGPQAALRQLTRVADAMRVGMDAVVEAMRGRLVDSLAARGIVPKVAREIS
FT                   AALPKAAMRADLHLSEAIANQAAYVLETHPKLGAMSAVHGVIAYRRLGESAAMNQLIHD
FT                   LRYAPAVAAAPEPMPAGVMEAIELSQRAVDANLANANRVYVEALDDSPKPGS"
     MIDGQEHDVA AEIRIPLIEG AFFAARDRLA SELATSGFDP HVAAAGANQI GEAILESPTQ        60
     NEDAAWLIAA MAPAGIARRL AGTDARNTRA ALIRDGIAPD IARAVVQIAP VSPRGPQAAL       120
     RQLTRVADAM RVGMDAVVEA MRGRLVDSLA ARGIVPKVAR EISAALPKAA MRADLHLSEA       180
     IANQAAYVLE THPKLGAMSA VHGVIAYRRL GESAAMNQLI HDLRYAPAVA AAPEPMPAGV       240
     MEAIELSQRA VDANLANANR VYVEALDDSP KPGS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page