(data stored in ACNUC7421 zone)

EMBL: CP000690.PE31

CP000690.PE31        Location/Qualifiers
FT   CDS             complement(41008..41421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28935"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK3"
FT                   /protein_id="ABQ28935.1"
FT                   /translation="MSARARKTGGLLLGILRVEGAPAQTRYELFPDEQGLIRWRRAMLR
FT                   RNWREWVAPAIDSAIAEGQLHDVRLLISDPEMLTDRQVDEVSLLYKIAVTFEAIPNMTV
FT                   LRDEPVAVRDQLSLFGDESEAVEADPLMAGPSP"
     MSARARKTGG LLLGILRVEG APAQTRYELF PDEQGLIRWR RAMLRRNWRE WVAPAIDSAI        60
     AEGQLHDVRL LISDPEMLTD RQVDEVSLLY KIAVTFEAIP NMTVLRDEPV AVRDQLSLFG       120
     DESEAVEADP LMAGPSP                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page