(data stored in ACNUC7421 zone)

EMBL: CP000690.PE32

CP000690.PE32        Location/Qualifiers
FT   CDS             41657..42250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3324"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: regulatory protein, MerR; Resolvase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28936"
FT                   /db_xref="GOA:A5FTK4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK4"
FT                   /protein_id="ABQ28936.1"
FT                   /translation="MLGVSITTLRRWEAAGKLVADHTAGGHRRYDIAKLRPDLFHAEDE
FT                   ADRRTIAYARVSSHDQKDDLERQKQVLELYCARQGWKFEIVADLGSGMNYRKKGLKKLL
FT                   GAIIDGSVGRLVIAHKDRLLRFGADLVFAICEAKNVEVVILNQGEDTTFEEDLAKDVLE
FT                   IITVFSARLYGSRSHKNQKLLDGVKRAVEESAAC"
     MLGVSITTLR RWEAAGKLVA DHTAGGHRRY DIAKLRPDLF HAEDEADRRT IAYARVSSHD        60
     QKDDLERQKQ VLELYCARQG WKFEIVADLG SGMNYRKKGL KKLLGAIIDG SVGRLVIAHK       120
     DRLLRFGADL VFAICEAKNV EVVILNQGED TTFEEDLAKD VLEIITVFSA RLYGSRSHKN       180
     QKLLDGVKRA VEESAAC                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page