(data stored in ACNUC7421 zone)

EMBL: CP000690.PE34

CP000690.PE34        Location/Qualifiers
FT   CDS             43830..44450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3326"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="PFAM: DNA recombination protein RuvA, domain I;
FT                   SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28938"
FT                   /db_xref="GOA:A5FTK6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK6"
FT                   /protein_id="ABQ28938.1"
FT                   /translation="MITQLTGIPRRIGDQECVIDVHGVGYGVHVPSATLDMIEGEAGPV
FT                   TILIQTRMSDSEISLYGFATPADLQTFRKLVGVQGVGPATALNLLSQLAPEELWRAIRE
FT                   ADQKALTAVKGIGPAAAKRLISELESHAAKLAAEMPAPAARLDLGLSADQLAQSLQRLG
FT                   HAPSAARAAAQFALNGAKPGDTEQELVARALQAAAGMTTGAAA"
     MITQLTGIPR RIGDQECVID VHGVGYGVHV PSATLDMIEG EAGPVTILIQ TRMSDSEISL        60
     YGFATPADLQ TFRKLVGVQG VGPATALNLL SQLAPEELWR AIREADQKAL TAVKGIGPAA       120
     AKRLISELES HAAKLAAEMP APAARLDLGL SADQLAQSLQ RLGHAPSAAR AAAQFALNGA       180
     KPGDTEQELV ARALQAAAGM TTGAAA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page