(data stored in ACNUC7421 zone)

EMBL: CP000690.PE35

CP000690.PE35        Location/Qualifiers
FT   CDS             44507..45445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3327"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28939"
FT                   /db_xref="GOA:A5FTK7"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK7"
FT                   /protein_id="ABQ28939.1"
FT                   /translation="MSPALRPQGLADFVGQADTMRNLATFIRAALIRGVSLDHVLLNGP
FT                   PGLGKTTIAQIIAHEMNCNLKTIIGPAVQRAADLAAVLTTMQPNEVLFIDEIHRVQPAA
FT                   AEILYGAMEDFTLDILIGEGPQARSVRIDLPRFTLIGATTRSGSLPAPLRDRFGIHLGL
FT                   EFYSPEDLVRIVTRSAGMLGIGMMPEGAMEIARRSRGTPRIANRLLRRVHDFAVVAGVV
FT                   AITDTIADMALSSLAVDRRGLDKLDRRYIDWIDTVHGGGPVGIDTLATGLGEARETIED
FT                   VIEPFLVASGIITRTSRGRVLTPKAYEVEAR"
     MSPALRPQGL ADFVGQADTM RNLATFIRAA LIRGVSLDHV LLNGPPGLGK TTIAQIIAHE        60
     MNCNLKTIIG PAVQRAADLA AVLTTMQPNE VLFIDEIHRV QPAAAEILYG AMEDFTLDIL       120
     IGEGPQARSV RIDLPRFTLI GATTRSGSLP APLRDRFGIH LGLEFYSPED LVRIVTRSAG       180
     MLGIGMMPEG AMEIARRSRG TPRIANRLLR RVHDFAVVAG VVAITDTIAD MALSSLAVDR       240
     RGLDKLDRRY IDWIDTVHGG GPVGIDTLAT GLGEARETIE DVIEPFLVAS GIITRTSRGR       300
     VLTPKAYEVE AR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page