(data stored in ACNUC7421 zone)

EMBL: CP000690.PE36

CP000690.PE36        Location/Qualifiers
FT   CDS             45445..45996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28940"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK8"
FT                   /protein_id="ABQ28940.1"
FT                   /translation="MQHRRDQRLMGTVDQLAPLFTTTVQNDIFLIGIDMGDPAHPAGAA
FT                   ILFSGDDEFYGQISDAMPASALSDLAVVFHAADKRIATMMRSSGRRALPREMPDGIASQ
FT                   DLKASPGLVAHRPPFAIIRGANEASGTVLVHLLIQAAGTAEWRTALRVSSGWLGRLAGL
FT                   AEEASRYPGQALVAQHHSPF"
     MQHRRDQRLM GTVDQLAPLF TTTVQNDIFL IGIDMGDPAH PAGAAILFSG DDEFYGQISD        60
     AMPASALSDL AVVFHAADKR IATMMRSSGR RALPREMPDG IASQDLKASP GLVAHRPPFA       120
     IIRGANEASG TVLVHLLIQA AGTAEWRTAL RVSSGWLGRL AGLAEEASRY PGQALVAQHH       180
     SPF                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page