(data stored in ACNUC7421 zone)

EMBL: CP000690.PE37

CP000690.PE37        Location/Qualifiers
FT   CDS             complement(46324..46656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28941"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK9"
FT                   /protein_id="ABQ28941.1"
FT                   /translation="MSRSTSPTAAPALRGVGPNLILNGNGFYVSYNDFDRGIYGGDTTA
FT                   LVLGQMERFFILNGDHRGQYAPPDRARLRCLSRLFPGQHGAHELPQRPAALPRHGWGGD
FT                   ADPVKG"
     MSRSTSPTAA PALRGVGPNL ILNGNGFYVS YNDFDRGIYG GDTTALVLGQ MERFFILNGD        60
     HRGQYAPPDR ARLRCLSRLF PGQHGAHELP QRPAALPRHG WGGDADPVKG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page