(data stored in ACNUC7421 zone)

EMBL: CP000690.PE38

CP000690.PE38        Location/Qualifiers
FT   CDS             46722..46973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28942"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL0"
FT                   /protein_id="ABQ28942.1"
FT                   /translation="MCHRFEIDAEYRRRRARLLAEKGTGFRSLGVGGADATTPHGRLML
FT                   TVLGGMVEFDREWILVLDVRMGPKPKLPLYQRHKALRR"
     MCHRFEIDAE YRRRRARLLA EKGTGFRSLG VGGADATTPH GRLMLTVLGG MVEFDREWIL        60
     VLDVRMGPKP KLPLYQRHKA LRR                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page