(data stored in ACNUC7421 zone)

EMBL: CP000690.PE39

CP000690.PE39        Location/Qualifiers
FT   CDS             47613..48353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3331"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28943"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL1"
FT                   /protein_id="ABQ28943.1"
FT                   /translation="MLSNYFDPPPMPTECSVTDGFACASRHASLQAPYPAHLRGVFVDG
FT                   SPRRMHRAPSLTAVTLLALSAFTPARAAELYHLNQRNSTIRFSVGTLGFFRARGHFAQF
FT                   DATLLIDPAHPTSTRVSVTIPTASVVTPWAQESAMIRSPDFFDVARYGKIRFTSGNVTA
FT                   TAPGHYAVHGQLTLRDVTRPVILAAHLVKTATDPTAGDTIDDFTITGTVRRKAFGIVAD
FT                   PVFIDNRVHIVIHARILVLASGHG"
     MLSNYFDPPP MPTECSVTDG FACASRHASL QAPYPAHLRG VFVDGSPRRM HRAPSLTAVT        60
     LLALSAFTPA RAAELYHLNQ RNSTIRFSVG TLGFFRARGH FAQFDATLLI DPAHPTSTRV       120
     SVTIPTASVV TPWAQESAMI RSPDFFDVAR YGKIRFTSGN VTATAPGHYA VHGQLTLRDV       180
     TRPVILAAHL VKTATDPTAG DTIDDFTITG TVRRKAFGIV ADPVFIDNRV HIVIHARILV       240
     LASGHG                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page