(data stored in ACNUC7421 zone)

EMBL: CP000690.PE4

CP000690.PE4         Location/Qualifiers
FT   CDS             7943..8677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3296"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28908"
FT                   /db_xref="GOA:A5FTH6"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH6"
FT                   /protein_id="ABQ28908.1"
FT                   /translation="MCNLSSVTKGQQAIRELTRAMLDTTGNLPSLPAIFPDALAPVVRN
FT                   APDGERELTMMRWGMPGPSQLGGAPVTNIRNTTSPHWRRWLPPQNRCLVPATSFSEWAD
FT                   TKPKKTPVWFALDQSRPLFAFAGLWTVWHGKRGTKANPIEGELRLFGFLTTEPNSIVRP
FT                   IHPKAMPVILTTPEEMDVWMRASWSEAAGLQRPLPGTKLVIMNYRRQAAHAALAKVSVT
FT                   MDRARSSPKIRWPMFHSTQADA"
     MCNLSSVTKG QQAIRELTRA MLDTTGNLPS LPAIFPDALA PVVRNAPDGE RELTMMRWGM        60
     PGPSQLGGAP VTNIRNTTSP HWRRWLPPQN RCLVPATSFS EWADTKPKKT PVWFALDQSR       120
     PLFAFAGLWT VWHGKRGTKA NPIEGELRLF GFLTTEPNSI VRPIHPKAMP VILTTPEEMD       180
     VWMRASWSEA AGLQRPLPGT KLVIMNYRRQ AAHAALAKVS VTMDRARSSP KIRWPMFHST       240
     QADA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page