(data stored in ACNUC7421 zone)

EMBL: CP000690.PE41

CP000690.PE41        Location/Qualifiers
FT   CDS             49942..50958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28945"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL3"
FT                   /protein_id="ABQ28945.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
     MDVLAREDLP FPQSLPEFQR IFPNDAACAA YLESARWNGG FACPRCGVVG EPFRFEARPG        60
     VLRCRACRKD VSLMAGTVME RSHTPLSTWF WAAYLIASQT PGMSAVQFQR QLGLSRYETA       120
     FGILHKLRAG MVRPERDKIG DTPQEHVEVD ETWVGGRTRG DGRGVHHKVL VACAVEVRHR       180
     KPGTKLDNRK DGRYAGRVRL AVVPDRSANS LCGFVENAVA PGSLIVTDDW SGYAGLGRRG       240
     FDHHAIAECG DPEVAEEFLP IVHLVFTNLK TWINGIHHGV SAKHLQAYLN EFTFRFNRRL       300
     YPFNAFRSLL GIAGRAAAPT FDELYSGEWT HPTFSGCG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page