(data stored in ACNUC7421 zone)

EMBL: CP000690.PE42

CP000690.PE42        Location/Qualifiers
FT   CDS             complement(51404..52369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3334"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28946"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL4"
FT                   /protein_id="ABQ28946.1"
FT                   /translation="MDITKVLENVDKNQIHKIINYLPIPIFIIASNYRFVSVNKPMCNF
FT                   FDCTIEAFLRKTDDFIIPKKNIDASRKITDEIFSSGQPYEDEEILTDGRGEQHIFLIYK
FT                   RLIHLQQAGYETPFVITVLMDVTRFREAEKNATHRALHDTLTGLANRSHLNQRLKEAVT
FT                   VSTANAQGFAILLLDLDGFKSINDRFGHQAGDQILCVVAKRLTDTIRRNDVVARLGGDE
FT                   FCIVQANVDHPDQAHELADRVVHAVSRPIPFGSIELTISASVGIALFPEDGDGPDALLR
FT                   KADLGLYQVKGNGRAGYLRHALDARSLQSDGRNHATNEWN"
     MDITKVLENV DKNQIHKIIN YLPIPIFIIA SNYRFVSVNK PMCNFFDCTI EAFLRKTDDF        60
     IIPKKNIDAS RKITDEIFSS GQPYEDEEIL TDGRGEQHIF LIYKRLIHLQ QAGYETPFVI       120
     TVLMDVTRFR EAEKNATHRA LHDTLTGLAN RSHLNQRLKE AVTVSTANAQ GFAILLLDLD       180
     GFKSINDRFG HQAGDQILCV VAKRLTDTIR RNDVVARLGG DEFCIVQANV DHPDQAHELA       240
     DRVVHAVSRP IPFGSIELTI SASVGIALFP EDGDGPDALL RKADLGLYQV KGNGRAGYLR       300
     HALDARSLQS DGRNHATNEW N                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page