(data stored in ACNUC7421 zone)

EMBL: CP000690.PE43

CP000690.PE43        Location/Qualifiers
FT   CDS             53072..53572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28947"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL5"
FT                   /protein_id="ABQ28947.1"
FT                   /translation="MSGIMPPPLPSPSQSFASALRAFLDTLIAVAAWRGEDFRQVWVVE
FT                   SAKAIRSAMEQGPIWATMEDLIPDDDDLLSKVAFDVLETEMLYVAFRYRRLLPEESRKV
FT                   VASVEERFAGVQEGDPTAPGAVDDIETVKGSIERQIKKLPKWLQRVLEVLMELLKLTKG
FT                   MIH"
     MSGIMPPPLP SPSQSFASAL RAFLDTLIAV AAWRGEDFRQ VWVVESAKAI RSAMEQGPIW        60
     ATMEDLIPDD DDLLSKVAFD VLETEMLYVA FRYRRLLPEE SRKVVASVEE RFAGVQEGDP       120
     TAPGAVDDIE TVKGSIERQI KKLPKWLQRV LEVLMELLKL TKGMIH                      166
//

If you have problems or comments...

PBIL Back to PBIL home page