(data stored in ACNUC7421 zone)

EMBL: CP000690.PE44

CP000690.PE44        Location/Qualifiers
FT   CDS             53885..54379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28948"
FT                   /db_xref="GOA:A5FTL6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL6"
FT                   /protein_id="ABQ28948.1"
FT                   /translation="MVSRAAAAACFGIALAMAMARYASLYRAMQIVGGLYLIWLGVGAS
FT                   RAKPGSAETGAVSARPAGLTRGILTGAVLNLGNLKIVVFFTSIFVALLPASAPLWVRLA
FT                   ATAIVGAQEAAWYILVAMLFSRPRAQVAYRRAGVWIERVVGMVLFGIGADIVVASVKSG
FT                   V"
     MVSRAAAAAC FGIALAMAMA RYASLYRAMQ IVGGLYLIWL GVGASRAKPG SAETGAVSAR        60
     PAGLTRGILT GAVLNLGNLK IVVFFTSIFV ALLPASAPLW VRLAATAIVG AQEAAWYILV       120
     AMLFSRPRAQ VAYRRAGVWI ERVVGMVLFG IGADIVVASV KSGV                        164
//

If you have problems or comments...

PBIL Back to PBIL home page