(data stored in ACNUC7421 zone)

EMBL: CP000690.PE45

CP000690.PE45        Location/Qualifiers
FT   CDS             complement(54386..55231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3337"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28949"
FT                   /db_xref="GOA:A5FTL7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL7"
FT                   /protein_id="ABQ28949.1"
FT                   /translation="MTIPPWAITAVLAGAALHAAWNVAIRGGADRRSATIGLILGGAVI
FT                   AGATLPFLPRPRAAAWPHLLATALLHIVYFNLVAEAYARGAVSLIYPVMRGTAPALTAL
FT                   IATIFLGETLGGAGWCGLLLISAGVGLLARRRGEAGEGRALMLALANAIIIALYTANDG
FT                   VGVRLSEAPLAYALWTFVLPAIPAILILARFSPTRLRAALKPGPLLRGFGGGACSIASY
FT                   ALALWAMTQAPIGAIAALRETALLFGVLFAWWFLHERPGSRGLTAIAIIAAGATVLRLG
FT                   "
     MTIPPWAITA VLAGAALHAA WNVAIRGGAD RRSATIGLIL GGAVIAGATL PFLPRPRAAA        60
     WPHLLATALL HIVYFNLVAE AYARGAVSLI YPVMRGTAPA LTALIATIFL GETLGGAGWC       120
     GLLLISAGVG LLARRRGEAG EGRALMLALA NAIIIALYTA NDGVGVRLSE APLAYALWTF       180
     VLPAIPAILI LARFSPTRLR AALKPGPLLR GFGGGACSIA SYALALWAMT QAPIGAIAAL       240
     RETALLFGVL FAWWFLHERP GSRGLTAIAI IAAGATVLRL G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page