(data stored in ACNUC7421 zone)

EMBL: CP000690.PE46

CP000690.PE46        Location/Qualifiers
FT   CDS             complement(55335..55895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3338"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28950"
FT                   /db_xref="GOA:A5FTL8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL8"
FT                   /protein_id="ABQ28950.1"
FT                   /translation="MISIQTPAHSVALTGAFMSASLHHRQAAFGGWLQKVSGAKRGRQE
FT                   LARLLDHLRAGDVVTVTRLDRLARSTRDLLDIAERIKEAGASLRSLAEPWADTTTPAGR
FT                   MVLTVFAGMADFERSLIVERTSTGRIAAKARGVRFGPQPALATDQIAHARQLIEADGKS
FT                   VAEVARLLGVHRATLYRALEKRQ"
     MISIQTPAHS VALTGAFMSA SLHHRQAAFG GWLQKVSGAK RGRQELARLL DHLRAGDVVT        60
     VTRLDRLARS TRDLLDIAER IKEAGASLRS LAEPWADTTT PAGRMVLTVF AGMADFERSL       120
     IVERTSTGRI AAKARGVRFG PQPALATDQI AHARQLIEAD GKSVAEVARL LGVHRATLYR       180
     ALEKRQ                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page