(data stored in ACNUC7421 zone)

EMBL: CP000690.PE47

CP000690.PE47        Location/Qualifiers
FT   CDS             55948..56460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3339"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28951"
FT                   /db_xref="GOA:A5FTL9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL9"
FT                   /protein_id="ABQ28951.1"
FT                   /translation="MAQAEAPGAVFAEVARRHDISRGQLWNWRRLVRAGELSLASAPAQ
FT                   FLPVRMSPELSAAAMIAGPEDTDRASVAAPRNQGRLEVRLAGGTRVVIEGMVAPAVVTA
FT                   PRIRTGTAVNICSARRMPAPSRLAATGWSTACGKQVFRSEKVRPKLKMRLIRRLNPEMV
FT                   GYSQKVA"
     MAQAEAPGAV FAEVARRHDI SRGQLWNWRR LVRAGELSLA SAPAQFLPVR MSPELSAAAM        60
     IAGPEDTDRA SVAAPRNQGR LEVRLAGGTR VVIEGMVAPA VVTAPRIRTG TAVNICSARR       120
     MPAPSRLAAT GWSTACGKQV FRSEKVRPKL KMRLIRRLNP EMVGYSQKVA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page