(data stored in ACNUC7421 zone)

EMBL: CP000690.PE48

CP000690.PE48        Location/Qualifiers
FT   CDS             56496..56885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28952"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM0"
FT                   /protein_id="ABQ28952.1"
FT                   /translation="MGTVRVMFRPRRQSPVVPVRLRRRAFFEGVFDMSALSMLSGHLSV
FT                   STAARVSAGQIAVALETGHLSAIGDSHARALVAGVFSEHDPDLILRATSEAGGTPATAN
FT                   ALYLESLADGMPCCPGWEHLMREIL"
     MGTVRVMFRP RRQSPVVPVR LRRRAFFEGV FDMSALSMLS GHLSVSTAAR VSAGQIAVAL        60
     ETGHLSAIGD SHARALVAGV FSEHDPDLIL RATSEAGGTP ATANALYLES LADGMPCCPG       120
     WEHLMREIL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page