(data stored in ACNUC7421 zone)

EMBL: CP000690.PE49

CP000690.PE49        Location/Qualifiers
FT   CDS             57023..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28953"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM1"
FT                   /protein_id="ABQ28953.1"
FT                   /translation="MLAYEHRISHDIDLFIHDAQWIGFLTPRLHDDAGRFPLYEEASNF
FT                   LKIKLPEGEIDFIVGMSLLGLADESYPGVPFALEPVAEVLAKKLFYRGASLTARDLYDW
FT                   WAVSSATPDVFPAAQVVSLLGSKVSGVETGLKNLSRSKAALGVWDALITSAKPKLTEAI
FT                   AWAENQLMVGPTLNVARTGRP"
     MLAYEHRISH DIDLFIHDAQ WIGFLTPRLH DDAGRFPLYE EASNFLKIKL PEGEIDFIVG        60
     MSLLGLADES YPGVPFALEP VAEVLAKKLF YRGASLTARD LYDWWAVSSA TPDVFPAAQV       120
     VSLLGSKVSG VETGLKNLSR SKAALGVWDA LITSAKPKLT EAIAWAENQL MVGPTLNVAR       180
     TGRP                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page