(data stored in ACNUC7421 zone)

EMBL: CP000690.PE52

CP000690.PE52        Location/Qualifiers
FT   CDS             complement(59338..59736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28956"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM4"
FT                   /protein_id="ABQ28956.1"
FT                   /translation="MPPGPLAYRLDRRELRLITPLSCHVLNRAKPVGQDRIGGDCLGLL
FT                   SETYVEVDPGCLGRLLQPLPLNAYTVGHGEQLIERVRPHVAHDHAAERVADIVNENGYS
FT                   GVPQAPPWKLASERICQITKTVSLIQYK"
     MPPGPLAYRL DRRELRLITP LSCHVLNRAK PVGQDRIGGD CLGLLSETYV EVDPGCLGRL        60
     LQPLPLNAYT VGHGEQLIER VRPHVAHDHA AERVADIVNE NGYSGVPQAP PWKLASERIC       120
     QITKTVSLIQ YK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page