(data stored in ACNUC7421 zone)

EMBL: CP000690.PE53

CP000690.PE53        Location/Qualifiers
FT   CDS             complement(59936..60745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3345"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28957"
FT                   /db_xref="GOA:A5FTM5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM5"
FT                   /protein_id="ABQ28957.1"
FT                   /translation="MAEDIERDLKPKPGVPLVRALDRGIALLRAFSLTKPRQTLTELTK
FT                   AAELDKGTTRRLLQTLIIAGLVDHDERSGLYALSVGVLEIASAVHTGRELREVAAPYLS
FT                   DIAELCHMTTFLWVHHDGMAVCTERVRSAQPSIDAPWFGVGARTPLNCGAGPRVLLANI
FT                   TPEERESALRKPLVARTPVSQTDPDELRQAAERIRAAGYELAVDDFVPGLAAIGVPVFD
FT                   RSGAFAGSISITSLTSQIVDNGKPRFLAELQKAALEIGRKLIEPHRL"
     MAEDIERDLK PKPGVPLVRA LDRGIALLRA FSLTKPRQTL TELTKAAELD KGTTRRLLQT        60
     LIIAGLVDHD ERSGLYALSV GVLEIASAVH TGRELREVAA PYLSDIAELC HMTTFLWVHH       120
     DGMAVCTERV RSAQPSIDAP WFGVGARTPL NCGAGPRVLL ANITPEERES ALRKPLVART       180
     PVSQTDPDEL RQAAERIRAA GYELAVDDFV PGLAAIGVPV FDRSGAFAGS ISITSLTSQI       240
     VDNGKPRFLA ELQKAALEIG RKLIEPHRL                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page