(data stored in ACNUC7421 zone)

EMBL: CP000690.PE55

CP000690.PE55        Location/Qualifiers
FT   CDS             61818..63128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3347"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28959"
FT                   /db_xref="GOA:A5FTM7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM7"
FT                   /protein_id="ABQ28959.1"
FT                   /translation="MSLDPALREKILASVESGFAEQIAFTEELIRFASVRGAEHACQDF
FT                   VFRALRERGFAMDRFAMDRDAIAAHPGGSPWSEQHSDAPIVVGIHYPQEEKGKSLILQA
FT                   HVDVVPPGPAEMWTNGAFNPVVEGDWLYGRGGADMKAGHAANFFCLDALRRIGLQPAAT
FT                   VYVQSVVEEESTGNGALMTHLRGYKADAVLIPEPEEEMLVRANVGVLWFRVEVRGRPVH
FT                   VREMGNGANAIDAAYRVISELRKLEQEWNDAKTGREHFADVEHPINLNIGKIEGGDWAS
FT                   SVPCWCRIDCRIGLYPGVNAAEASKEISDRVAAFARSDAFMGNNPPSVTFNGFHAEGYV
FT                   QAPGTEAEAVLARAHEGSTGKPLQSFMTPGYLDTRVYALYDKIPALCYGPISENIHGFD
FT                   ERVSIASLKRITGTMALFVAEWCGVEPIKTWPRCHGG"
     MSLDPALREK ILASVESGFA EQIAFTEELI RFASVRGAEH ACQDFVFRAL RERGFAMDRF        60
     AMDRDAIAAH PGGSPWSEQH SDAPIVVGIH YPQEEKGKSL ILQAHVDVVP PGPAEMWTNG       120
     AFNPVVEGDW LYGRGGADMK AGHAANFFCL DALRRIGLQP AATVYVQSVV EEESTGNGAL       180
     MTHLRGYKAD AVLIPEPEEE MLVRANVGVL WFRVEVRGRP VHVREMGNGA NAIDAAYRVI       240
     SELRKLEQEW NDAKTGREHF ADVEHPINLN IGKIEGGDWA SSVPCWCRID CRIGLYPGVN       300
     AAEASKEISD RVAAFARSDA FMGNNPPSVT FNGFHAEGYV QAPGTEAEAV LARAHEGSTG       360
     KPLQSFMTPG YLDTRVYALY DKIPALCYGP ISENIHGFDE RVSIASLKRI TGTMALFVAE       420
     WCGVEPIKTW PRCHGG                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page