(data stored in ACNUC7421 zone)

EMBL: CP000690.PE58

CP000690.PE58        Location/Qualifiers
FT   CDS             67234..67698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28962"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN0"
FT                   /protein_id="ABQ28962.1"
FT                   /translation="MRLCHSPFSRRHHPLFVRAVQDQIEQLWFRPSARPPDPSAAQSLE
FT                   SFRRFTAASEAGDLVAVRSESGGQVRFWLTNIDGLSRARGLLFTEDWPEFGDHAWLLAT
FT                   GRNAFCPDGQDRLVIPTAAVIRFIEEFPHGVAIDASSSRAALLSPDMASG"
     MRLCHSPFSR RHHPLFVRAV QDQIEQLWFR PSARPPDPSA AQSLESFRRF TAASEAGDLV        60
     AVRSESGGQV RFWLTNIDGL SRARGLLFTE DWPEFGDHAW LLATGRNAFC PDGQDRLVIP       120
     TAAVIRFIEE FPHGVAIDAS SSRAALLSPD MASG                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page