(data stored in ACNUC7421 zone)

EMBL: CP000690.PE6

CP000690.PE6         Location/Qualifiers
FT   CDS             9556..11154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3298"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28910"
FT                   /db_xref="GOA:A5FTH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH8"
FT                   /protein_id="ABQ28910.1"
FT                   /translation="MPPQPGGVLARAPPWSRPSGPRRIPRHNGETFVPGRHINDHQKRL
FT                   FMRYRQTDGVALAAAKAGFSTAAGYRLEQERHLPSSPKPPRGRRRPDPLATIFDAEVVP
FT                   LLEAAPGLRAVAIFEEMCRRHPDLAPGVRRTLERRIRTWRALHGPEQEVIFRQTHEPGA
FT                   MGLSDFTDMNELGIIVAGAPLDHRLYHFRLVWSGFEHAHVILGGESYVALAEGLQNALW
FT                   LLGGAPREHRSDSLSAAFRNLTAENVADLTRRYDALCTHYGMTPSRNNRGVAHENGAIE
FT                   SPHGHLKRAVRDALLLRGSTVFVDLEAYRRFIAEIVGRQNRRHAERIDAERAALQKLPD
FT                   QRTADYEETVVTVTSSGGFTLRKVFYTVPSRLIGQRLRVRLYDNRLELFLAATPLMTLP
FT                   RGRPQPDGRHGHVVDYRHVIHSLRRKPMALLNLVYRHQLFPRDAYRRTFEHLLEQTPPR
FT                   DACRIMVELLAIAHERACEAELASVLAADIKAGRQPDLKAIRQRFAPDPASLPALTIPT
FT                   MPLASYDILLQGAAA"
     MPPQPGGVLA RAPPWSRPSG PRRIPRHNGE TFVPGRHIND HQKRLFMRYR QTDGVALAAA        60
     KAGFSTAAGY RLEQERHLPS SPKPPRGRRR PDPLATIFDA EVVPLLEAAP GLRAVAIFEE       120
     MCRRHPDLAP GVRRTLERRI RTWRALHGPE QEVIFRQTHE PGAMGLSDFT DMNELGIIVA       180
     GAPLDHRLYH FRLVWSGFEH AHVILGGESY VALAEGLQNA LWLLGGAPRE HRSDSLSAAF       240
     RNLTAENVAD LTRRYDALCT HYGMTPSRNN RGVAHENGAI ESPHGHLKRA VRDALLLRGS       300
     TVFVDLEAYR RFIAEIVGRQ NRRHAERIDA ERAALQKLPD QRTADYEETV VTVTSSGGFT       360
     LRKVFYTVPS RLIGQRLRVR LYDNRLELFL AATPLMTLPR GRPQPDGRHG HVVDYRHVIH       420
     SLRRKPMALL NLVYRHQLFP RDAYRRTFEH LLEQTPPRDA CRIMVELLAI AHERACEAEL       480
     ASVLAADIKA GRQPDLKAIR QRFAPDPASL PALTIPTMPL ASYDILLQGA AA               532
//

If you have problems or comments...

PBIL Back to PBIL home page