(data stored in ACNUC7421 zone)

EMBL: CP000690.PE60

CP000690.PE60        Location/Qualifiers
FT   CDS             complement(68322..68723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3353"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28964"
FT                   /db_xref="GOA:A5FTN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN2"
FT                   /protein_id="ABQ28964.1"
FT                   /translation="MIDQESSADLLIHFGQLIRKVRISFGVRQADLAAMVGTRQATISE
FT                   LERGRLNIHLDLALNLMRHLGIEIREPEAHSDDAQITEEAMSVPDIDNIIPPPSRRTPC
FT                   NPEAGLPTSSAPSDQNGDPADDPPAEPAP"
     MIDQESSADL LIHFGQLIRK VRISFGVRQA DLAAMVGTRQ ATISELERGR LNIHLDLALN        60
     LMRHLGIEIR EPEAHSDDAQ ITEEAMSVPD IDNIIPPPSR RTPCNPEAGL PTSSAPSDQN       120
     GDPADDPPAE PAP                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page