(data stored in ACNUC7421 zone)

EMBL: CP000690.PE61

CP000690.PE61        Location/Qualifiers
FT   CDS             complement(68839..69462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28965"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN3"
FT                   /protein_id="ABQ28965.1"
FT                   /translation="MLSTSGYRRLVGDLADARCIWPVNRRLYLNREASPAAGPDEAAEH
FT                   LEPGAIVSLQRVLGAHGILNNPSAYVTAVVPLRTGHPPPTLGHRATEAGVFVFKGIPAA
FT                   VLAAGEEEDRLEALNRPFPGRMPIATPEKALIDWIYLGSSPRSDMLLPPIHDIDLETLD
FT                   RERLGRLAKAAGPAVEAAVSAWMEKADQHVHYDDREDDGPIPGF"
     MLSTSGYRRL VGDLADARCI WPVNRRLYLN REASPAAGPD EAAEHLEPGA IVSLQRVLGA        60
     HGILNNPSAY VTAVVPLRTG HPPPTLGHRA TEAGVFVFKG IPAAVLAAGE EEDRLEALNR       120
     PFPGRMPIAT PEKALIDWIY LGSSPRSDML LPPIHDIDLE TLDRERLGRL AKAAGPAVEA       180
     AVSAWMEKAD QHVHYDDRED DGPIPGF                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page