(data stored in ACNUC7421 zone)

EMBL: CP000690.PE62

CP000690.PE62        Location/Qualifiers
FT   CDS             complement(69561..70400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28966"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN4"
FT                   /protein_id="ABQ28966.1"
FT                   /translation="MTVSSLIRGTPNDADVARELLQYEVVRSIFVKSTEREIALKGGFA
FT                   MRALFGSARHTKDIDLQHDARRANLARTQTLIRSAIRNAVATGILEDVRISEPKQTDTV
FT                   ARWKIGGRTVGGSQVALTIEVSRRPMPGDDCLTRMEMQPPAEIGGALVMVDTYSADAMA
FT                   GAKTIALLSENRLAPRDLWDLDILITMRAEPPPHMIDHLRTERARQALFDKLDTMSWKL
FT                   FREEVLPTLPAGVAEALDRDAFEEMKVRVALAVEKWLADGDRSPDRRPDNQEPGPTP"
     MTVSSLIRGT PNDADVAREL LQYEVVRSIF VKSTEREIAL KGGFAMRALF GSARHTKDID        60
     LQHDARRANL ARTQTLIRSA IRNAVATGIL EDVRISEPKQ TDTVARWKIG GRTVGGSQVA       120
     LTIEVSRRPM PGDDCLTRME MQPPAEIGGA LVMVDTYSAD AMAGAKTIAL LSENRLAPRD       180
     LWDLDILITM RAEPPPHMID HLRTERARQA LFDKLDTMSW KLFREEVLPT LPAGVAEALD       240
     RDAFEEMKVR VALAVEKWLA DGDRSPDRRP DNQEPGPTP                              279
//

If you have problems or comments...

PBIL Back to PBIL home page