(data stored in ACNUC7421 zone)

EMBL: CP000690.PE64

CP000690.PE64        Location/Qualifiers
FT   CDS             71007..71858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28968"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN6"
FT                   /protein_id="ABQ28968.1"
FT                   /translation="MRGAATARQSGSTRRDSSFGAPAFRAFGPGARSPPESGGGRSLDR
FT                   IAHRPRLCRRRAVIPGWLMLQNLEIDPRGALEGPVLQTPRFVNRHRALDPGRGDDETPD
FT                   RLHELCQARLSCLSGDRQRPKCQPFARSRIFAVCPELSGDCGARRPLASDPVPITCPER
FT                   GLHVEKGSPDKPVLLPADRQQKRTDDLGGDLASNSLIRSAAGIPFLDPTDEGFGIAGGG
FT                   VHSSEQGACGGPDAHCLPVVPPADYLAEIHRGTPSNASRSLLTNRVTNKPATGLPGAEA
FT                   FA"
     MRGAATARQS GSTRRDSSFG APAFRAFGPG ARSPPESGGG RSLDRIAHRP RLCRRRAVIP        60
     GWLMLQNLEI DPRGALEGPV LQTPRFVNRH RALDPGRGDD ETPDRLHELC QARLSCLSGD       120
     RQRPKCQPFA RSRIFAVCPE LSGDCGARRP LASDPVPITC PERGLHVEKG SPDKPVLLPA       180
     DRQQKRTDDL GGDLASNSLI RSAAGIPFLD PTDEGFGIAG GGVHSSEQGA CGGPDAHCLP       240
     VVPPADYLAE IHRGTPSNAS RSLLTNRVTN KPATGLPGAE AFA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page