(data stored in ACNUC7421 zone)

EMBL: CP000690.PE65

CP000690.PE65        Location/Qualifiers
FT   CDS             complement(71903..73144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3358"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28969"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN7"
FT                   /protein_id="ABQ28969.1"
FT                   /translation="MREFPGSLTLMPEEGRAGYGHLLDLSFSLAAESAELGGMMRAPTR
FT                   RAIARLVRAMDCYYSNLIEGREARPKDIQRALSENYSSDPAVRDKQVEARAHIKVQERI
FT                   DDGAYDRLGLGTELIRSIHKDFYLHMPESFRSVELNGVRHRVVPGEFRNLYVVVGRHEA
FT                   VAPEMVPGFMAHFEAGYRGVGPAFSLIAAAASHHRLAWIHPFLDGNGRTARLYTHAWFR
FT                   RFTKGADLWSVSRGLARTLGDYRSKLARADYPPQGGTDGRGTLSASGLAEFCAYFLETA
FT                   LDQVRFMRDMLAPDTLLPRLRLFVQHEAEAGRLDPRAFAILELAYLRGHVPKGEVETLL
FT                   GVSERHARRIVTPLVEQGLLESEGRSAPFTIGFPLEEADLVFPRLFQMPAAATQAKFLD
FT                   AVRSDDAVDDMPAP"
     MREFPGSLTL MPEEGRAGYG HLLDLSFSLA AESAELGGMM RAPTRRAIAR LVRAMDCYYS        60
     NLIEGREARP KDIQRALSEN YSSDPAVRDK QVEARAHIKV QERIDDGAYD RLGLGTELIR       120
     SIHKDFYLHM PESFRSVELN GVRHRVVPGE FRNLYVVVGR HEAVAPEMVP GFMAHFEAGY       180
     RGVGPAFSLI AAAASHHRLA WIHPFLDGNG RTARLYTHAW FRRFTKGADL WSVSRGLART       240
     LGDYRSKLAR ADYPPQGGTD GRGTLSASGL AEFCAYFLET ALDQVRFMRD MLAPDTLLPR       300
     LRLFVQHEAE AGRLDPRAFA ILELAYLRGH VPKGEVETLL GVSERHARRI VTPLVEQGLL       360
     ESEGRSAPFT IGFPLEEADL VFPRLFQMPA AATQAKFLDA VRSDDAVDDM PAP              413
//

If you have problems or comments...

PBIL Back to PBIL home page