(data stored in ACNUC7421 zone)

EMBL: CP000690.PE66

CP000690.PE66        Location/Qualifiers
FT   CDS             complement(73293..74399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28970"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN8"
FT                   /protein_id="ABQ28970.1"
FT                   /translation="MLLCDQVVAMRNRILAVPGALQAATSSIQRIVSVADTLPSAPRFI
FT                   LANDVTEALITSSIDYPEALTGCIDAIRIPWRCAWFEWDDDFARDTWRRAHVRQRVQDD
FT                   NFMPKRVGFIVETDEGGRRGEISVLWPVPESDGKGGLTSNYDGMVMSNLPTVHFDLDRQ
FT                   DLDARVMVGAASLERATGIPIPEIGFNNELEPGRARYLDRIRATMMMDWSNSGVAKLIT
FT                   HLGHYNPVEFVSNAVADIWSEYCMLVPAAAMMNARQAVRTAPVDRTRLNKARLKSGRSP
FT                   LLDHQVVSMNVSPEERAERRRVAAGGAARPRATHWVRGHLVHRGGTIFWRRPHIRMGVG
FT                   DVPVGRTVRVHGQPEIRPEVDDMPAPGQ"
     MLLCDQVVAM RNRILAVPGA LQAATSSIQR IVSVADTLPS APRFILANDV TEALITSSID        60
     YPEALTGCID AIRIPWRCAW FEWDDDFARD TWRRAHVRQR VQDDNFMPKR VGFIVETDEG       120
     GRRGEISVLW PVPESDGKGG LTSNYDGMVM SNLPTVHFDL DRQDLDARVM VGAASLERAT       180
     GIPIPEIGFN NELEPGRARY LDRIRATMMM DWSNSGVAKL ITHLGHYNPV EFVSNAVADI       240
     WSEYCMLVPA AAMMNARQAV RTAPVDRTRL NKARLKSGRS PLLDHQVVSM NVSPEERAER       300
     RRVAAGGAAR PRATHWVRGH LVHRGGTIFW RRPHIRMGVG DVPVGRTVRV HGQPEIRPEV       360
     DDMPAPGQ                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page