(data stored in ACNUC7421 zone)

EMBL: CP000690.PE67

CP000690.PE67        Location/Qualifiers
FT   CDS             74540..75703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28971"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN9"
FT                   /protein_id="ABQ28971.1"
FT                   /translation="MSGQSQSGQSGQTSQARPEAADREHYVWHHMRQPNGFTCGSTCVR
FT                   MLSSILLAGEPDPPRLHPEVIAGMMGTSPRTGTTEIEMKRGLDLYGIPHERMPPTADGA
FT                   GPGRMEDLIGWLKAGNMAMLRCLFFGMKHWILATHADARGIHVLDPAAQSPGILSPDRV
FT                   ASLIQPRGWEFWKIPANAPCRELHFGRLPRPGIATEVMQDAVVGLLLDHGDLDRRMIPP
FT                   EAAGWLVGQLMRSERSYGLWDGNRLLATHIASGCQPWKVLEDAGFTVDEATMERLRAQL
FT                   ARLPGAVYHSLATAVHPDVEENGGRWLVDAAPGLFGFAGVHGIERADEAAGGRAGDTLL
FT                   ELRHDEMRYFVREAPNFDGVAALEEVVTGPTRGPSDEDAQGPGPSPG"
     MSGQSQSGQS GQTSQARPEA ADREHYVWHH MRQPNGFTCG STCVRMLSSI LLAGEPDPPR        60
     LHPEVIAGMM GTSPRTGTTE IEMKRGLDLY GIPHERMPPT ADGAGPGRME DLIGWLKAGN       120
     MAMLRCLFFG MKHWILATHA DARGIHVLDP AAQSPGILSP DRVASLIQPR GWEFWKIPAN       180
     APCRELHFGR LPRPGIATEV MQDAVVGLLL DHGDLDRRMI PPEAAGWLVG QLMRSERSYG       240
     LWDGNRLLAT HIASGCQPWK VLEDAGFTVD EATMERLRAQ LARLPGAVYH SLATAVHPDV       300
     EENGGRWLVD AAPGLFGFAG VHGIERADEA AGGRAGDTLL ELRHDEMRYF VREAPNFDGV       360
     AALEEVVTGP TRGPSDEDAQ GPGPSPG                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page