(data stored in ACNUC7421 zone)

EMBL: CP000690.PE68

CP000690.PE68        Location/Qualifiers
FT   CDS             complement(75757..76203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP0"
FT                   /protein_id="ABQ28972.1"
FT                   /translation="MLRPLLRQVEDAKVLSSDACGAEGISICLTDARDTETGAPFIACR
FT                   LNEGGVVAVSGYGMIFVAPPWRGLGLGAELSLYSRMLEDDDGHGAHLYSPGGLAAAISG
FT                   YELGCRIGADLGYHDRLADVMIDAGLMRRRYGLDRPRGSPSPEA"
     MLRPLLRQVE DAKVLSSDAC GAEGISICLT DARDTETGAP FIACRLNEGG VVAVSGYGMI        60
     FVAPPWRGLG LGAELSLYSR MLEDDDGHGA HLYSPGGLAA AISGYELGCR IGADLGYHDR       120
     LADVMIDAGL MRRRYGLDRP RGSPSPEA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page