(data stored in ACNUC7421 zone)

EMBL: CP000690.PE7

CP000690.PE7         Location/Qualifiers
FT   CDS             11151..12026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3299"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28911"
FT                   /db_xref="GOA:A5FTH9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH9"
FT                   /protein_id="ABQ28911.1"
FT                   /translation="MSETARTVDAQRLTLLLNELRLPAIKQVWPDFAARADKEAWPAAR
FT                   LLATLAEHEVAERDRRRIERHLLEARLPPGKTIATFTFEAVPMISKAQILALCSGDGWL
FT                   ETGANLLAFGPPGGGKSHLAAAIGLALVENGWRVLFTRTSDLVQKLQIARRELALEATI
FT                   AKLDKFHPLILDDLAYVTKDQAETSVLFELISARYERRSLMITANQPFGEWGKVFPDPA
FT                   MTLAAVDRLVHHATIFEMNVESYRRKTAIQRRAGPGRPPTRATINENIRLSLHDNQVAE
FT                   TRLPASNQSD"
     MSETARTVDA QRLTLLLNEL RLPAIKQVWP DFAARADKEA WPAARLLATL AEHEVAERDR        60
     RRIERHLLEA RLPPGKTIAT FTFEAVPMIS KAQILALCSG DGWLETGANL LAFGPPGGGK       120
     SHLAAAIGLA LVENGWRVLF TRTSDLVQKL QIARRELALE ATIAKLDKFH PLILDDLAYV       180
     TKDQAETSVL FELISARYER RSLMITANQP FGEWGKVFPD PAMTLAAVDR LVHHATIFEM       240
     NVESYRRKTA IQRRAGPGRP PTRATINENI RLSLHDNQVA ETRLPASNQS D                291
//

If you have problems or comments...

PBIL Back to PBIL home page