(data stored in ACNUC7421 zone)

EMBL: CP000690.PE71

CP000690.PE71        Location/Qualifiers
FT   CDS             78680..80134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3364"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28975"
FT                   /db_xref="GOA:A5FTP3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024023"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP3"
FT                   /protein_id="ABQ28975.1"
FT                   /translation="MASFLKPEAFEPDPRAMRLLPFRFERISDDVVIISNFVGELMFAT
FT                   DNEMSRLVSLDLKPGDGLFERAREKLLVSVGSERAPLELLALRLRSRLAFLRNPTPLHI
FT                   FVVTLRCEHSCPYCQVSRQSSDRNQFDMSDETAMRAIDVAMSTPGDSLKIEFQGGEPLL
FT                   NFDLIQRVVDVASKEAVSLGKSVQFVIASNLAMLDDDILDFCKQRSVLISTSLDGPADL
FT                   HNRNRPRPGGNSHELAVRNIQRAQGVLGRDRVGALMTTTEASLDRAEEIIDEYLALGLE
FT                   GIFLRPLSPYGFAMKTRQFSKYDGEAWFRFYVRGLKYILEINKSGRRFPEFYASLLLRR
FT                   MLTDRADGYVDLRSPMGAGLGTLVYNYDGDVFASDEGRMLAEMGDRTFKLGNLASADYA
FT                   KLALSEKLIDLASRSLTQSAPQCSSCAFEPHCGADPVYHHATQGDPVGIKRFSEFCGRQ
FT                   KRIIGFLANLLEKSPDDAAILRGWAS"
     MASFLKPEAF EPDPRAMRLL PFRFERISDD VVIISNFVGE LMFATDNEMS RLVSLDLKPG        60
     DGLFERAREK LLVSVGSERA PLELLALRLR SRLAFLRNPT PLHIFVVTLR CEHSCPYCQV       120
     SRQSSDRNQF DMSDETAMRA IDVAMSTPGD SLKIEFQGGE PLLNFDLIQR VVDVASKEAV       180
     SLGKSVQFVI ASNLAMLDDD ILDFCKQRSV LISTSLDGPA DLHNRNRPRP GGNSHELAVR       240
     NIQRAQGVLG RDRVGALMTT TEASLDRAEE IIDEYLALGL EGIFLRPLSP YGFAMKTRQF       300
     SKYDGEAWFR FYVRGLKYIL EINKSGRRFP EFYASLLLRR MLTDRADGYV DLRSPMGAGL       360
     GTLVYNYDGD VFASDEGRML AEMGDRTFKL GNLASADYAK LALSEKLIDL ASRSLTQSAP       420
     QCSSCAFEPH CGADPVYHHA TQGDPVGIKR FSEFCGRQKR IIGFLANLLE KSPDDAAILR       480
     GWAS                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page