(data stored in ACNUC7421 zone)

EMBL: CP000690.PE72

CP000690.PE72        Location/Qualifiers
FT   CDS             80122..81303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3365"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28976"
FT                   /db_xref="GOA:A5FTP4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP4"
FT                   /protein_id="ABQ28976.1"
FT                   /translation="MGVVTPLALAGRAITICWSNVSANRFIVRVQDPASCAQGPADAAL
FT                   IRSVDDAENAKRSGFKSAVGIGLSTDKATGFDQLILLDGRFDYLSDGDILRVHPNTNHI
FT                   RTLYRRASQHNAFLVTERCNHWCLMCSQPPRNVSDGWIIDEIAECFPLLNPQPRSLGFT
FT                   GGEPMTDWERFINLLSLAKDQLPSVALHVLTNGRAFAKPPIAVAWAALRHPSLTAGIPI
FT                   YAAAGHLHDYIVQSMGAFDETVMGILRLKDQGQRVEVRVVLHALSVPRLVETAIWLGRN
FT                   LPFVDHVALMGLEQTGFAIANQDQLWIEPTEYAAQLAEAVLILQSAGIRVSVYNLPLCL
FT                   LPRPVWPASVQSISDWKNGFLPECEECAKRGDCPGFFSSGRKAVGRKVRPIKL"
     MGVVTPLALA GRAITICWSN VSANRFIVRV QDPASCAQGP ADAALIRSVD DAENAKRSGF        60
     KSAVGIGLST DKATGFDQLI LLDGRFDYLS DGDILRVHPN TNHIRTLYRR ASQHNAFLVT       120
     ERCNHWCLMC SQPPRNVSDG WIIDEIAECF PLLNPQPRSL GFTGGEPMTD WERFINLLSL       180
     AKDQLPSVAL HVLTNGRAFA KPPIAVAWAA LRHPSLTAGI PIYAAAGHLH DYIVQSMGAF       240
     DETVMGILRL KDQGQRVEVR VVLHALSVPR LVETAIWLGR NLPFVDHVAL MGLEQTGFAI       300
     ANQDQLWIEP TEYAAQLAEA VLILQSAGIR VSVYNLPLCL LPRPVWPASV QSISDWKNGF       360
     LPECEECAKR GDCPGFFSSG RKAVGRKVRP IKL                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page