(data stored in ACNUC7421 zone)

EMBL: CP000690.PE73

CP000690.PE73        Location/Qualifiers
FT   CDS             81684..83159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3366"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28977"
FT                   /db_xref="GOA:A5FTP5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP5"
FT                   /protein_id="ABQ28977.1"
FT                   /translation="MTKASGNPTDDISGLLEDGIGVFDDAGELHVPLRRGRGGTPVAGT
FT                   RGDWGLEDPPAPPIVPAPGMNDRVSNWAARNIIAPAILAIIQPTGLDREQAGRVHDAVR
FT                   RLIPAGLPPGALNLHGAVKLLFGMEFRSLPLKTRCETLEMLLAWMGLTEEVGLEIFGED
FT                   IWRALPFHWNQRVAELDTSDDAVAPAEVAAGATDPRRDVATGVIVVREIGNSDNDSAKR
FT                   ADKAVTSLVQKPLPLFRSNRLDTFRERMVADFPHAATAIDDLYWDLTTRDHVAWTPRIL
FT                   VGNPGVGKTSFVEAACLVLEIPYLKYPCGGDTDSVSFRGASRKWSTTSPSLPLSLIASH
FT                   QIANPVIILDEIEKAGTSRYNGNLLDVLLGMMDRKQASGWYDPHVEAPIDLRHVNWLAT
FT                   ANSTKDLPPAIRDRFRMVSRIADPSAEHGPHLVKALLRQVVAERGPGAAMIEPLGLDEI
FT                   EAITGIWGGGSVRQLQTVLEHWLRQRDRSASRH"
     MTKASGNPTD DISGLLEDGI GVFDDAGELH VPLRRGRGGT PVAGTRGDWG LEDPPAPPIV        60
     PAPGMNDRVS NWAARNIIAP AILAIIQPTG LDREQAGRVH DAVRRLIPAG LPPGALNLHG       120
     AVKLLFGMEF RSLPLKTRCE TLEMLLAWMG LTEEVGLEIF GEDIWRALPF HWNQRVAELD       180
     TSDDAVAPAE VAAGATDPRR DVATGVIVVR EIGNSDNDSA KRADKAVTSL VQKPLPLFRS       240
     NRLDTFRERM VADFPHAATA IDDLYWDLTT RDHVAWTPRI LVGNPGVGKT SFVEAACLVL       300
     EIPYLKYPCG GDTDSVSFRG ASRKWSTTSP SLPLSLIASH QIANPVIILD EIEKAGTSRY       360
     NGNLLDVLLG MMDRKQASGW YDPHVEAPID LRHVNWLATA NSTKDLPPAI RDRFRMVSRI       420
     ADPSAEHGPH LVKALLRQVV AERGPGAAMI EPLGLDEIEA ITGIWGGGSV RQLQTVLEHW       480
     LRQRDRSASR H                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page