(data stored in ACNUC7421 zone)

EMBL: CP000690.PE74

CP000690.PE74        Location/Qualifiers
FT   CDS             83313..83666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28978"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP6"
FT                   /protein_id="ABQ28978.1"
FT                   /translation="MFNILQFSDHGYFAPQKIAKELKTSSEDVARSAGLGRDAVQRANR
FT                   VQSDRTQRRLREMVEILNKSTPRFGSLLMAYAWYRSQPLPGFSGQTPMQLVMHGRANEV
FT                   LEYLDAVDAGIHA"
     MFNILQFSDH GYFAPQKIAK ELKTSSEDVA RSAGLGRDAV QRANRVQSDR TQRRLREMVE        60
     ILNKSTPRFG SLLMAYAWYR SQPLPGFSGQ TPMQLVMHGR ANEVLEYLDA VDAGIHA          117
//

If you have problems or comments...

PBIL Back to PBIL home page