(data stored in ACNUC7421 zone)

EMBL: CP000690.PE75

CP000690.PE75        Location/Qualifiers
FT   CDS             83663..84184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28979"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP7"
FT                   /protein_id="ABQ28979.1"
FT                   /translation="MTAASYKGLLYRAINPIYAADPMSGEGARLYGGRFNPRGVPAIYC
FT                   SISVMTALREANQAGALQPTTLVSYDAEIERVFDARDVSAVEAEGFSPGTLASQTWRDE
FT                   MKAGKQSQTQVFASRLIAKNYCALLVPSYVAGATPSDLNLVLWKWGSSTPSRLVLIDDQ
FT                   GRLAVPPLPA"
     MTAASYKGLL YRAINPIYAA DPMSGEGARL YGGRFNPRGV PAIYCSISVM TALREANQAG        60
     ALQPTTLVSY DAEIERVFDA RDVSAVEAEG FSPGTLASQT WRDEMKAGKQ SQTQVFASRL       120
     IAKNYCALLV PSYVAGATPS DLNLVLWKWG SSTPSRLVLI DDQGRLAVPP LPA              173
//

If you have problems or comments...

PBIL Back to PBIL home page