(data stored in ACNUC7421 zone)

EMBL: CP000690.PE76

CP000690.PE76        Location/Qualifiers
FT   CDS             complement(84188..86872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3369"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28980"
FT                   /db_xref="GOA:A5FTP8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP8"
FT                   /protein_id="ABQ28980.1"
FT                   /translation="MHSIYILFLSQLQRVSRLKHMNASGTTLRDALDEIELARPTAQAV
FT                   SENPDSPLMTMSVANVLDLRNALLSREVSFRGFSVPILKQIFSHLDEAGYSHAGAARAQ
FT                   MNARQQDDARVAALAAVFRVLALVPFPEALLEADPAIRLRRILEDFVAARDSKDDWRAG
FT                   VHTLADLLSDWKGIMTRLQQADNFGAKSTTDLKLLVDGALLRATEAVASVVSKKDVATE
FT                   RLNLAGILAGDIPVPLQHMIGRADLDKVRDALPAFLAEPAHHLLGGSHGRKNRATELPG
FT                   FPGVIMRNEKQAQILAMRYGFFDKPATLDVVSNTVGITKERVRQIEVEAVKHLGREPSR
FT                   QKVEPIIEAHLPQLIEILTDGTGYLPDEASGEINRKAMIAHGVPGTVVLGLEALFPSAS
FT                   DLANRYGTRQGNGWLLGLDDKARGRAQATSKLLSTRLRGRRNAILVSDAMEAAGATTSE
FT                   ISAAVAMVPGAAIVGRHIIRDIDQLNERRAYQLYDLAIKLDDGAPFDLTRLCEAYAAAT
FT                   PEENNMPNCVPRAIAGAKGMFLNVIDRIWFPLQEKLPERPAGHAPLPYTIRPDMSQTSI
FT                   WRRPFGENTVAHFLHGQITRHGPIRTLDLAELTLPENYGSRSETLSGAQPIMKMNPNFV
FT                   HLSPGIYGLVEQLPKLTDPRRALPEVLLADRIVRAYTDARRVSPAAARIYPIWDMAFEY
FT                   RLARWAAEHANKKVAGALFDVVDPRMWPIAEDEITRWQAVKAEMSDRKQHHQTEQPDEY
FT                   ALPPADRFLASMITLWWMGEISWTLIGRTTNQRDMHTPASHLALLARFGLARAPKHWQD
FT                   RHLPTADLRPTLEAVIRDAVHADGISWRNPEMRALLSRDAGPGGWVDNDAVSRALQRPG
FT                   DPQLSVYGRTKVRRGRVLQPVNG"
     MHSIYILFLS QLQRVSRLKH MNASGTTLRD ALDEIELARP TAQAVSENPD SPLMTMSVAN        60
     VLDLRNALLS REVSFRGFSV PILKQIFSHL DEAGYSHAGA ARAQMNARQQ DDARVAALAA       120
     VFRVLALVPF PEALLEADPA IRLRRILEDF VAARDSKDDW RAGVHTLADL LSDWKGIMTR       180
     LQQADNFGAK STTDLKLLVD GALLRATEAV ASVVSKKDVA TERLNLAGIL AGDIPVPLQH       240
     MIGRADLDKV RDALPAFLAE PAHHLLGGSH GRKNRATELP GFPGVIMRNE KQAQILAMRY       300
     GFFDKPATLD VVSNTVGITK ERVRQIEVEA VKHLGREPSR QKVEPIIEAH LPQLIEILTD       360
     GTGYLPDEAS GEINRKAMIA HGVPGTVVLG LEALFPSASD LANRYGTRQG NGWLLGLDDK       420
     ARGRAQATSK LLSTRLRGRR NAILVSDAME AAGATTSEIS AAVAMVPGAA IVGRHIIRDI       480
     DQLNERRAYQ LYDLAIKLDD GAPFDLTRLC EAYAAATPEE NNMPNCVPRA IAGAKGMFLN       540
     VIDRIWFPLQ EKLPERPAGH APLPYTIRPD MSQTSIWRRP FGENTVAHFL HGQITRHGPI       600
     RTLDLAELTL PENYGSRSET LSGAQPIMKM NPNFVHLSPG IYGLVEQLPK LTDPRRALPE       660
     VLLADRIVRA YTDARRVSPA AARIYPIWDM AFEYRLARWA AEHANKKVAG ALFDVVDPRM       720
     WPIAEDEITR WQAVKAEMSD RKQHHQTEQP DEYALPPADR FLASMITLWW MGEISWTLIG       780
     RTTNQRDMHT PASHLALLAR FGLARAPKHW QDRHLPTADL RPTLEAVIRD AVHADGISWR       840
     NPEMRALLSR DAGPGGWVDN DAVSRALQRP GDPQLSVYGR TKVRRGRVLQ PVNG             894
//

If you have problems or comments...

PBIL Back to PBIL home page