(data stored in ACNUC7421 zone)

EMBL: CP000690.PE77

CP000690.PE77        Location/Qualifiers
FT   CDS             complement(87261..87539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28981"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP9"
FT                   /protein_id="ABQ28981.1"
FT                   /translation="MNTKIWATKQRVKSMSSMPMPARLVWTDGHDRAPGGFRHADRVHG
FT                   RDARGAVVKAVTDSSVVGPSRASPKAIRPGFRRIASAMEAAQYCCLA"
     MNTKIWATKQ RVKSMSSMPM PARLVWTDGH DRAPGGFRHA DRVHGRDARG AVVKAVTDSS        60
     VVGPSRASPK AIRPGFRRIA SAMEAAQYCC LA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page