(data stored in ACNUC7421 zone)

EMBL: CP000690.PE78

CP000690.PE78        Location/Qualifiers
FT   CDS             87871..88137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3371"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28982"
FT                   /db_xref="GOA:A5FTQ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ0"
FT                   /protein_id="ABQ28982.1"
FT                   /translation="MIKDAQAFGALVQARRKSLGLTQRQLALAINSGERFIVDLEAGKT
FT                   TCQLGKALAAANAVGIELADTGARGASTERRGEQELDLPEVDL"
     MIKDAQAFGA LVQARRKSLG LTQRQLALAI NSGERFIVDL EAGKTTCQLG KALAAANAVG        60
     IELADTGARG ASTERRGEQE LDLPEVDL                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page