(data stored in ACNUC7421 zone)

EMBL: CP000690.PE79

CP000690.PE79        Location/Qualifiers
FT   CDS             88134..89282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3372"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28983"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ1"
FT                   /protein_id="ABQ28983.1"
FT                   /translation="MSDHTPVFYETLLVGMIHTDTRGSCFTYDESWLSRTGSFQISLTM
FT                   PLGRPAVEHHVIMPWLANLLPEGDAISTIARRSGIATGDILSLLMVVGRDTAGALSIGQ
FT                   PRSREGRHYMTIAGQDALERLIEDLPRRPLLSGDDGVSMSLPGAQEKLPVVLNDNDIAL
FT                   PLNGAPSTHIIKPNNRRLPGSVQNEALCMVLARRVGLDVADVTTGQAGKRSYLLVERYD
FT                   RIQRGGVWRRLHQEDFCQALSLPPASKYQHNRTGILGPGLADLFRTVRTFMTARDTIRL
FT                   LDAVIFNVLITNVDSHAKNYSIMLTGRARLSPLYDLMAGDAWSEVTQNLPQDIGGKNRG
FT                   QYINHLHWRRMAEESGLSAGAVVRRVIQMATALPSMLDQAVD"
     MSDHTPVFYE TLLVGMIHTD TRGSCFTYDE SWLSRTGSFQ ISLTMPLGRP AVEHHVIMPW        60
     LANLLPEGDA ISTIARRSGI ATGDILSLLM VVGRDTAGAL SIGQPRSREG RHYMTIAGQD       120
     ALERLIEDLP RRPLLSGDDG VSMSLPGAQE KLPVVLNDND IALPLNGAPS THIIKPNNRR       180
     LPGSVQNEAL CMVLARRVGL DVADVTTGQA GKRSYLLVER YDRIQRGGVW RRLHQEDFCQ       240
     ALSLPPASKY QHNRTGILGP GLADLFRTVR TFMTARDTIR LLDAVIFNVL ITNVDSHAKN       300
     YSIMLTGRAR LSPLYDLMAG DAWSEVTQNL PQDIGGKNRG QYINHLHWRR MAEESGLSAG       360
     AVVRRVIQMA TALPSMLDQA VD                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page