(data stored in ACNUC7421 zone)

EMBL: CP000690.PE8

CP000690.PE8         Location/Qualifiers
FT   CDS             complement(12089..12448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28912"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI0"
FT                   /protein_id="ABQ28912.1"
FT                   /translation="MALVMRRVTLKLYPSATQATEMERVCDLHRALYNAALQERIDAWR
FT                   LSKTSIGYAAQCKSVTQIRRDDTAYLGLNAQSLQVTLKRLDMAFSHFFRRVKAGETPGF
FT                   PRYKGRDRFPGWGYM"
     MALVMRRVTL KLYPSATQAT EMERVCDLHR ALYNAALQER IDAWRLSKTS IGYAAQCKSV        60
     TQIRRDDTAY LGLNAQSLQV TLKRLDMAFS HFFRRVKAGE TPGFPRYKGR DRFPGWGYM        119
//

If you have problems or comments...

PBIL Back to PBIL home page