(data stored in ACNUC7421 zone)

EMBL: CP000690.PE80

CP000690.PE80        Location/Qualifiers
FT   CDS             89444..89701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3373"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28984"
FT                   /db_xref="GOA:A5FTQ2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ2"
FT                   /protein_id="ABQ28984.1"
FT                   /translation="MRLYFLVLDELGYLPFAQTGGQLLFHLISRLYERTSIIVTTNLAF
FT                   GEWPSVFGDAKMTTALLDRLTHHCEIIETGNDSWRFKNRA"
     MRLYFLVLDE LGYLPFAQTG GQLLFHLISR LYERTSIIVT TNLAFGEWPS VFGDAKMTTA        60
     LLDRLTHHCE IIETGNDSWR FKNRA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page