(data stored in ACNUC7421 zone)

EMBL: CP000690.PE81

CP000690.PE81        Location/Qualifiers
FT   CDS             90016..90147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28985"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ3"
FT                   /protein_id="ABQ28985.1"
FT                   /translation="MEAGKRRLAGDTARAATTGEVQDLRREARALKITGKPRSLSEC"
     MEAGKRRLAG DTARAATTGE VQDLRREARA LKITGKPRSL SEC                          43
//

If you have problems or comments...

PBIL Back to PBIL home page