(data stored in ACNUC7421 zone)

EMBL: CP000690.PE83

CP000690.PE83        Location/Qualifiers
FT   CDS             93356..93748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28987"
FT                   /db_xref="GOA:A5FTQ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ5"
FT                   /protein_id="ABQ28987.1"
FT                   /translation="MNAGATLPNATLKVLEEEGEPEFSTRDVCAIAKVTAPTLYHHIGS
FT                   ADIPTAEEAFTLLTACVAAIAGEGSLTQKVDAAPDIMWTSTKAASLLCGTASLRKLSTP
FT                   TAAVLEQKRQGAFRSILKSKSNVQSQ"
     MNAGATLPNA TLKVLEEEGE PEFSTRDVCA IAKVTAPTLY HHIGSADIPT AEEAFTLLTA        60
     CVAAIAGEGS LTQKVDAAPD IMWTSTKAAS LLCGTASLRK LSTPTAAVLE QKRQGAFRSI       120
     LKSKSNVQSQ                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page