(data stored in ACNUC7421 zone)

EMBL: CP000690.PE84

CP000690.PE84        Location/Qualifiers
FT   CDS             complement(94167..94619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28988"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ6"
FT                   /protein_id="ABQ28988.1"
FT                   /translation="MTRVRRFRRTFGNNRRENATAPEGSACKKTFEIAADDKAVERGDR
FT                   HQIHAARLIMAAHGRGHDKIALPLVRRDPYQDRGSEIEVPVVFPQHKLPLRTRQDRKER
FT                   HGRETFGLGILPYPPRGLYSTQRNDSVAEAEQRLKPGWWVFQRLAR"
     MTRVRRFRRT FGNNRRENAT APEGSACKKT FEIAADDKAV ERGDRHQIHA ARLIMAAHGR        60
     GHDKIALPLV RRDPYQDRGS EIEVPVVFPQ HKLPLRTRQD RKERHGRETF GLGILPYPPR       120
     GLYSTQRNDS VAEAEQRLKP GWWVFQRLAR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page