(data stored in ACNUC7421 zone)

EMBL: CP000690.PE85

CP000690.PE85        Location/Qualifiers
FT   CDS             94823..96502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3379"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28989"
FT                   /db_xref="GOA:A5FTQ7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ7"
FT                   /protein_id="ABQ28989.1"
FT                   /translation="MFFRIKPSGGRRYLQIVENKRVDGKVRQVVRLTIGRMDELEASGQ
FT                   LARLLTSGARHCEQMMLLSAIENEATTLSMRRFGAPLLFGRLWQESGIAAVFEELLAGR
FT                   QFEFPVERAVFATVLHRIMVSGSDRACDKWLEDYDIPGTEELGLHHLYRAMAWLGEELP
FT                   DEEQGDATPFAPRTVKDLVEERLFARQHDLFTDLSVVFMDTTSLYFEGADGETLGARGH
FT                   SKDYRPQLAQMILGVVIDQDGRPICTEMWPGNTADVSVLVPVIDRLRSRFGITRVCVVA
FT                   DRGMISAATIAALEERGLEYVLGARERTDRIVREVVLADERPYIPLCLERAGGDETQLF
FT                   IKEVKVAGKHYIVCRNEAVAIEEAETRRQVVAALDRQLTRGDKALIGNSAYRRFLRPVS
FT                   DAKPGRKSKLFEIDAGKLAEEARFDGVFVLRSNARISPLQAVLRYRDLQNVEQLFRVAK
FT                   ATMRTRPIYHSSAAAIRGHVFCSFLALILHQALDEKLRRAGKRVEWADLLRDLDRLQHG
FT                   EISQNGKRWQLRTEAGVAAATAFKAARIALPPRLQTPQQAVT"
     MFFRIKPSGG RRYLQIVENK RVDGKVRQVV RLTIGRMDEL EASGQLARLL TSGARHCEQM        60
     MLLSAIENEA TTLSMRRFGA PLLFGRLWQE SGIAAVFEEL LAGRQFEFPV ERAVFATVLH       120
     RIMVSGSDRA CDKWLEDYDI PGTEELGLHH LYRAMAWLGE ELPDEEQGDA TPFAPRTVKD       180
     LVEERLFARQ HDLFTDLSVV FMDTTSLYFE GADGETLGAR GHSKDYRPQL AQMILGVVID       240
     QDGRPICTEM WPGNTADVSV LVPVIDRLRS RFGITRVCVV ADRGMISAAT IAALEERGLE       300
     YVLGARERTD RIVREVVLAD ERPYIPLCLE RAGGDETQLF IKEVKVAGKH YIVCRNEAVA       360
     IEEAETRRQV VAALDRQLTR GDKALIGNSA YRRFLRPVSD AKPGRKSKLF EIDAGKLAEE       420
     ARFDGVFVLR SNARISPLQA VLRYRDLQNV EQLFRVAKAT MRTRPIYHSS AAAIRGHVFC       480
     SFLALILHQA LDEKLRRAGK RVEWADLLRD LDRLQHGEIS QNGKRWQLRT EAGVAAATAF       540
     KAARIALPPR LQTPQQAVT                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page